High-Protein Overnight Oats

⏱ 10 min · 🍽️ 4 Servings · 🧂 8 Ingredients

Ingredients

  • 240 g rolled oats
  • 600 g skyr
  • 400 ml milk
  • 40 g chia seeds
  • 60 g vanilla protein powder
  • 30 g honey
  • 1 pinch salt
  • 150 g fresh berries to serve

Instructions

  1. In a large bowl, stir together the oats, skyr, milk, chia seeds, protein powder, honey and salt until you have a smooth, creamy mixture.
  2. Divide the mixture between four jars or containers and level the tops, leaving room for the chia seeds to swell.
  3. Seal the jars and refrigerate overnight, at least six hours, until the oats are thick and spoonable.
  4. In the morning, finish to taste: version one with fresh berries, version two with a teaspoon of cocoa and sliced banana, version three with a spoonful of peanut butter and a pinch of cinnamon. Stir and enjoy.
← Back
High-Protein Overnight Oats
📖 Culinse
breakfastmeal-prepvegetarianeasy

High-Protein Overnight Oats

Creamy oats soaked overnight with skyr and chia, packing over 30 grams of protein per serving. One base mix, three easy flavor twists..

Cook time

10 min

🍽️

Servings

4

🧂

Ingredients

8